
PLAP/AALP Human Recombinant Protein
Product Description Placental alkaline phosphatase (PLAP), also referred to as PLAP, is an enzyme predominantly located in the membranal layer of syncytiotrophoblasts within the placenta during the third trimester of pregnancy. Initially believed to be exclusively present in full-term placentas, a human PLAP-like variant has been identified, sharing over 85% homology with PLAP itself. PLAP expression is primarily observed in normal term placentas, the endocervix, fallopian tube, as well as in ovarian and proximal gastrointestinal tumors. Moreover, it is commonly found in germ cell tumors and has more recently been detected in seminomas. Our products are produced using a proprietary plant based expressed system. Animal Component Free (ACF). No endotoxins, prions or virons to risk microbial contamination. Highly flexible platform used to produce multiple proteins with minimal changes to method. Our fusion tech is highly-engineered and tested to be hyper-thermal stable and protease-resistant. Price Match Guarantee If you find a lower price of PLAP recombinant protein, send us a copy of the estimate or a link to the online listing and we'll match the price for quantity. It's that EASY! Send to orders@spectrumbiosource.com. Current Lead Time 1-2 Working Days Product Specifications Species Human Expression System Nicotiana Benthamiana Purity >95% by SDS-PAGE Activity Activity Assay Animal Component Free (ACF) Yes Molecular Weight 53.9 kDa Structure Dimer Endotoxin Concentration <1 EU/µg Form Frozen Formulation 50mM Tris, 10% glycerol, pH 7.8 *For Research Use Only Amino Acid Sequence IIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKK DKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQ CNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQ EGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKR QGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLS RNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSH VFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYR QQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPPA GTTD Spectrum BioSource Guarantee If your product PLAP is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. Storage Instructions Reconstituted store at -20°C or -80°C.We recommend that single use aliquots re prepared to avoid freeze-thaw cycles. Reconstitution Instructions Thaw the vial on ice, spin briefly Prepare single-use or stock aliquots. This stage will depend on your final application so please adapt as appropriate. All our proteins are supplied carrier protein-free. If compatible with your work and you are storing at lower concentrations (<50 ug/ml) adding carrier protein is highly advised (usually 1% w/v high purity BSA or equivalent – ensure all buffers are sterile-filtered). Prepare single-use aliquots whenever possible to avoid freeze-thaw cycles which can damage the proteins and reduce bioactivity. Store aliquots at -70 °C (or -20 °C) We recommend sterile filtering after dilution in media or the final working solution Bioinformatics Alternative Names: Alkaline phosphatase Regan isozyme, Placental alkaline phosphatase 1, PLAP-1, AALP UniProt ID: P05187 Entrez Gene ID: Documents & Downloads References