VEGF-165 Recombinant Protein

Product Description VEGF-165, or vascular endothelial growth factor 165, is a protein that plays a crucial role in angiogenesis, which is the formation of new blood vessels. It's a member of the PDGF (Platelet-Derived Growth Factors) family that is characterized by the presence of eight conserved cysteine residues and a cystine knot structure. In simpler terms, it's like a molecular architect that signals the body to build new blood vessels, particularly important in processes like wound healing and the development of collateral blood vessels to improve blood flow in ischemic tissues. This specific isoform, VEGF-165, is one of several VEGF isoforms, each with slightly different properties and functions. Our products are produced using a proprietary plant based expressed system. Animal Component Free (ACF). No endotoxins, prions or virons to risk microbial contamination. Highly flexible platform used to produce multiple proteins with minimal changes to method. Because of the plant based source, our proteins generally have been found to have a 10% to 20% higher activity compared to e.coli. Purchase Through Fisher Scientific (No Discount) Price Match Guarantee If you find a lower price of VEGF-165 recombinant protein, send us a copy of the estimate or a link to the online listing and we'll match the price for quantity. It's that EASY! Send to orders@mnpharm.com. Current Lead Time 1-2 Working Days Product Specifications Species Human* Expression System Nicotiana Benthamiana Purity >95% by SDS-PAGE Activity 0.3-3.75 ng/mL EC50 Activity Assay Induced HUVEC proliferation assay dataCell proliferation is measured by RezasurinrhVEGF165 MNPHARM, ED50 = 4.557 ng/mLUsing 2 mg/mL concentration measurement Animal Component Free (ACF) Yes Molecular Weight 38.2 kDa Structure Disulfide-linked homodimer Endotoxin Concentration <1 EU/µg Purification Sequential Chromatography Form Frozen Formulation Supplied as a 0.22 µm filtered solution, 25 mM HEPES, 150 mM NaCl, 10% glycerol, pH 7.0 *For Research Use Only Sequence APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR MNPharm Guarantee If your product VEGF-165 is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. Storage Instructions Store in aliquots at -20°C or -80°C.We recommend that single use aliquots are prepared to avoid freeze-thaw cycles. Sample Prep Instructions Thaw the vial on ice, spin briefly Prepare single-use or stock aliquots. This stage will depend on your final application so please adapt as appropriate. All our proteins are supplied carrier protein-free. If compatible with your work and you are storing at lower concentrations (<50 ug/ml) adding carrier protein is highly advised (usually 1% w/v high purity BSA or equivalent – ensure all buffers are sterile-filtered). Prepare single-use aliquots whenever possible to avoid freeze-thaw cycles which can damage the proteins and reduce bioactivity. Store aliquots at -70 °C (or -20 °C) We recommend sterile filtering after dilution in media or the final working solution Bioinformatics Alternative Names: MVCD1; MVCD-1; VAS; vascular endothelial growth factor A; Vascular endothelial growth factor 2; Vascular permeability factor; Vasculotropin; VEGF; VEGFA; VEGF-A; VEGFMGC70609; VPF; VPF vascular endothelial growth factor; MGC70609 UniProt ID: (Human) P15692 Entrez Gene ID: (Human) 7422 Documents & Downloads COA is included in the shipment References Leung, D.W. et al. (1989) Science 246:1306. Keck, P.J. et al. (1989) Science 246:1309. Byrne, A.M. et al. (2005) J. Cell. Mol. Med. 9:777. Robinson, C.J. and S.E. Stringer (2001) J. Cell. Sci. 114:853. Pan, Q. et al. (2007) J. Biol. Chem. 282:24049. Weis, S.M. and D.A. Cheresh (2005) Nature 437:497. Thurston, G. (2002) J. Anat. 200:575. Carvalho, J.F. et al. (2007) J. Clin. Immunol. 27:246. Angelo, L.S. and R. Kurzrock (2007) Clin. Cancer Res. 13:2825. Apte, R.S. et al. (2019) Cell 176(6):1248. Sangro, B. et al. (2021) Nature 18:525-543. Hu, K. & Olsen, B.R. (2016) Bone 91:30-38. Zhou, Y. et al. (2022) Cancers 14:2266. Li, Y. et al. (2018) Cell Stem Cell 23(2):181-192. Musah, S. et al. (2018) Nat. Protoc. 13(7):1662-1685. Meseguer-Ripolles, J. et al. (2021) STAR Protoc. 2(2):100502. Hutchings, G. et al. (2020) Int. J. Mol. Sci. 21(11):3790. Zhang, W. et al. (2014) Euro Cell and Mater. 27:1-12.