Recombinant MIP-3α/CCL20, Rat - BK0324

Recombinant MIP-3α/CCL20, Rat - BK0324

$155.29
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Recombinant MIP-3α/CCL20, Rat Catalogue Numbers: BK0324-5, BK0324-25 Sizes: 5μg, 25μg Source: HEK 293 Molecular Weight: 8.2 kDa, observed by reducing SDS-PAGE. Purity: > 98% as analyzed by SDS-PAGE. Biological Activity: The EC50 value of rat MIP-3 α/CCL20 on Caˆ2+ mobilization assay in CHO-K1/ Ga15/rCCR6 cells (human Ga15 and rat CCR6 stably expressed in CHO-K1 cells) is less than 0.6 μg/ml. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: ASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRIL HLLSLRTKKM Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant Rat MIP-3 α/CCL20 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant Rat MIP-3 α/CCL20 should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description: Macrophage Inflammatory Protein-3 (MIP-3α), also known as chemokine (C-C motif) ligand 20 (CCL20) or liver activation regulated chemokine (LARC), is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. MIP-3αis implicated in the formation and function of mucosal lymphoid tissues via chemoattraction of lymphocytes and dendritic cells toward the epithelial cells surrounding these tissues. MIP-3αis expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor.Recombinant rat MIP-3 α/CCL20 produced in HEK293 cells is a polypeptide chain containing 71 amino acids. A fully biologically active molecule, rrMIP-3 α/CCL20 has a molecular mass of 8.2 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Show More Show Less

Price History

$155.29 (+$23.29)