Recombinant Human MIP-3 alpha (rHuMIP-3a/CCL20) - PR1096
afsbio.com

Recombinant Human MIP-3 alpha (rHuMIP-3a/CCL20) - PR1096

$185.88
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}
Store Logo

AFSBio Inc.

View Store

Recombinant Human MIP-3 alpha (rHuMIP-3a/CCL20) Catalogue Numbers: PR1096-5, PR1096-20 Sizes: 5µg, 20µg Source: Escherichia coli Molecular Weight: 8.0 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids. Purity: >97% by SDS-PAGE and HPLC analyses. Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 10.0 -50.0 ng/ml, corresponding to a Specific Activity of ＞2 x 104 IU/mg. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl. AA Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM Endotoxin: Less than 1EU/mg of rHuMIP-3a/CCL20 as determined by LAL method. Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute

Show More Show Less