
Recombinant MIP-3α/CCL20, Human (CHO-expressed) - BK0272
Recombinant MIP-3α/CCL20, Human (CHO-expre Ssed) Catalogue Numbers: BK0272-5, BK0272-25 Sizes: 5μg, 25μg Source: CHO Molecular Weight: 8 kDa, observed by reducing SDS-PAGE. Purity: > 98% as analyzed by SDS-PAGE. Biological Activity: The EC50 value of humanMIP-3 alpha/CCL20 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR6 cells (human Ga15 and human CCR6 stably expressed in CHO-K1 cells) is less than 200 ng/ml. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIV RLLSKKVKNM Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant Human MIP-3 alpha/CCL20 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human MIP-3 alpha/CCL20 should be stable up to 1 week at 4°C or up to 2 months at -20°C. U