Recombinant Rat Matrilysin (MMP7) Protein (GST)

Recombinant Rat Matrilysin (MMP7) Protein (GST)

$549.60
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Recombinant Rat Matrilysin (MMP7) Protein (GST) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb P50280 Target Symbol MMP7 Synonyms Mmp7; Mmp-7Matrilysin; EC 3.4.24.23; Matrin; Matrix metalloproteinase-7; MMP-7; Pump-1 protease; Uterine metalloproteinase Species Rattus norvegicus (Rat) Expression System E.coli Tag N-GST Target Protein Sequence FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL Expression Range 98-267aa Protein Length Full Length of Mature Protein Mol. Weight 45.9kDa Research Area Others Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer,

Show More Show Less