Recombinant Horse Growth/Differentiation Factor 8 (MSTN) Protein (His)

Product Overview Description Recombinant Horse Growth/Differentiation Factor 8 (MSTN) Protein (His) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 90% as determined by SDS-PAGE. Uniprotkb Q9GM97 Target Symbol MSTN Species Equus caballus (Horse) Expression System E.coli Tag N-6His Target Protein Sequence DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS Expression Range 267-375aa Protein Length Full Length of Mature Protein Mol. Weight 18.4 kDa Research Area Cancer Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. Target Details Target Function Acts specifically as a negative regulator of skeletal muscle growth. Subcellular Location Secreted. Protein Families TGF-beta family Database References KEGG: ecb:100033832 STRING: 9796.ENSECAP00000018852 UniGene: Eca.12515 Gene Functions References The association between a single nucleotide polymorphism and hypertrophy of muscle fiber in racehorses was studied. PMID: 29058242 identified several mitochondrial phenotypes associated with MSTN genotype in untrained Thoroughbred horses and in addition, our findings suggest that nutritional supplementation with CoQ may aid to restore coenzyme Q activity in TT/NN horses PMID: 29190290 The effect of an Equine Repetitive Element 1 insertion in the promoter of the myostatin gene, which is involved in muscle development, was also investigated. PMID: 26503543 Myostatin mRNA but not protein was increased in skeletal muscle of obese compared with lean animals. Myostatin mRNA was increased in crest fat of obese animals and protein was undetectable. Serum myostatin was higher in obese than lean animals. PMID: 25390640 All three target polymorphisms (Ins227bp, g.66493737 T succeeds C, BIEC2-417495) are suitable markers to assess the ability of non-elite Thoroughbreds to race at short or longer distances. PMID: 26100061 Genotype frequencies in Icelandic horses vary depending on whether the horses were used for meat or riding PMID: 26095686 The tissue-specific presence of myostatin, the moystatin receptor (activin receptor IIB, ActRIIB), follistatin and perilipin, genes and proteins across a range of equine tissues, were examined. PMID: 24956155 The SINE insertion was genotyped in 227 horses from 10 breeds belonging to different morphological types (brachimorphic, mesomorphic, meso-dolichomorphic and dolichomorphic). PMID: 25273961 The candidate for racing performance genomic region contained eight genes annotated by ENSEMBL, including the myostatin gene (MSTN). PMID: 21070273 Polymorphisms of the MSTN promoter region in 5 horse breeds in Poland are reported. PMID: 25403076 significant association observed between genotype and mRNA abundance for untrained horses with the C/C cohort having highest MSTN mRNA levels,T/T group lowest levels and C/T group intermediate levels; following training there was significant decrease in MSTN mRNA which was most apparent for the C/C cohort PMID: 22497477 Exon 2 of the MSTN gene, which encodes part of the TGF-beta pro-peptide, was sequenced in 332 horses of 20 different breeds and compared with the horse MSTN gene sequence deposited in GenBank. The sequences obtained revealed the presence of 11 haplotypes represented by 10 variable nucleotide mutations, eight of them corresponding to amino acid sequence changes. PMID: 22404361 Variation at the MSTN gene influences speed in Thoroughbred horses. PMID: 22016373 This study demonstrates that the g.66493737C>T single nucleotide polymorphism in MSTN provides the most powerful genetic marker for prediction of race distance aptitude in Thoroughbreds. PMID: 20932346 Characterized the horse (Equus caballus) MSTN gene and identified and analysed single nucleotide polymorphisms (SNPs) in breeds of different morphological types. PMID: 20706663