Biotinylated Recombinant Enterobacteria Phage T4 Recombination Protein Uvsy (UVSY) Protein (MBP&His-Avi)

Biotinylated Recombinant Enterobacteria Phage T4 Recombination Protein Uvsy (UVSY) Protein (MBP&His-Avi)

$946.40
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Product Overview Description Biotinylated Recombinant Enterobacteria Phage T4 Recombination Protein Uvsy (UVSY) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a full length protein. Purity Greater than 85% as determined by SDS-PAGE. Uniprotkb P04537 Target Symbol UVSY Species Enterobacteria phage T4 (Bacteriophage T4) Expression System E.coli Tag N-MBP&C-6His-Avi Target Protein Sequence MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK Expression Range 1-137aa Protein Length Full Length Mol. Weight 63.6kDa Research Area Others Form Liquid or Lyophilized powder Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution Briefly centrifuged the vial prior to opening to bri

Show More Show Less