Recombinant PF-4/CXCL4, Human - BK0328

Recombinant PF-4/CXCL4, Human - BK0328

$183.53
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Recombinant PF-4/CXCL4, Human Catalogue Numbers: BK0328-10, BK0328-50 Sizes: 10μg, 50μg Source: HEK 293 Molecular Weight: ~7.8 kDa, observed by non-reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50 < 10 ug/ml, measured by its ability to inhibit human FGF-basic-dependent proliferation of NR6R 3T3 mouse fibroblast cells. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant human platelet factor 4 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human platelet factor 4 should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage: This material is offered by USA Bioworld bi

Show More Show Less

Price History

$183.53 (+$27.53)