Recombinant M-CSF, Mouse - BK0268

Recombinant M-CSF, Mouse - BK0268

$268.24
{{option.name}}: {{selected_options[option.position]}}
{{value_obj.value}}

Recombinant M-CSF, Mouse Catalogue Numbers: BK0268-10, BK0268-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 35-44 kDa, observed by non-reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50< 3 ng/ml, measured in a cell proliferation assay using Murine M-NFS-60 cells, corresponding to a specific activity of > 3.3×10ˆ5 units/mg. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERL QELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP Endotoxin: <0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant murine Macrophage-Colony Stimulating Factor (M-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description: Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages[1]. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells[2]. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of of several diseases, including breast and endometrial cancers [1][3][4] .

Show More Show Less

Price History

$268.24 (+$40.24)