Recombinant IL-6, Rat (HEK293-expressed) - BK0317

Recombinant IL-6, Rat(HEK293-expre Ssed) Catalogue Numbers: BK0317-5, BK0317-25 Sizes: 5μg, 25μg Source: HEK 293 Molecular Weight: 21~26 kDa , observed by reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE. Biological Activity: ED50 < 3 pg/ml, measured by a cell proliferation assay using 7TD1 Cells. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: FPTSQVRRGDFTEDTTHNRPVYTTSQVGGLITYVLREILEMRKELCNGNSDCMNSDDALSENNLKLPEIQRNDGCFQTGY NQEICLLKICSGLLEFRFYLEFVKNNLQDNKKDKARVIQSNTETLVHIFKQEIKDSYKIVLPTPTSNALLMEKLESQKEW LRTKTIQLILKALEEFLKVTMRSTRQT Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant Rat Interleukin-6(IL-6) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, it should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description: Interleukin-6 (IL-6) is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. Produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes, Interleukin-6 (IL-6) has diverse biological functions. It stimulates B-cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. Interleukin-6 (IL-6) signals through the IL-6 receptor system that consists of two chains, IL-6R alpha and gp130.