Recombinant GM-CSF, Human (CHO-expressed) - BK0211

Recombinant GM-CSF, Human (CHO-expre Ssed) Catalogue Numbers: BK0211-10, BK0211-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 22-28 kDa, observed by non-reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50 < 0.2 ng/ml, measured in a cell proliferation assay using TF-1 cells, corresponding to a specific activity of > 5×10ˆ6 units/mg. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: APARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNEt VEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMM ASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE Endotoxin: < 0.2 EU/μg, determined by LAL method. Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml. Storage: Lyophilized recombinant human Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhGM-CSF should be st